Scaffold Ga0209526_10375393

Overview

Basic Information

• Taxon OID: 3300028047
• Scaffold ID: Ga0209526_10375393
• Source Dataset Name: Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 948
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 35-63-5 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location

• Location Name: Algoma, Ontario, Canada
• Coordinates
  • Lat. (^o): 46.42
  • Long. (^o): -83.37

Associated Families

Family	Category	Number of Sequences	3D Structure?
F015364	Metagenome / Metatranscriptome	255	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209526_103753932	F015364	GAGG	MPPRRKKPTDDDIYLKRREEGRALVDAAHTATHRLYCETLAFWRRCALRTCRRHRRCLGEPTGCLLRGLPFVPEPERLRAQDAVIAGGPRRLAPASHIEWCLRRTELATVTSWGFGTAPK