Scaffold Ga0256844_10066795

Overview

Basic Information

• Taxon OID: 3300028042
• Scaffold ID: Ga0256844_10066795
• Source Dataset Name: Mussel associated microbial communities from hydrothermal vent at the East Pacific Rise, Pacific Ocean - Mussels
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1223
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Peniculida → Parameciidae → Paramecium → Paramecium tetraurelia (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mollusca → Shell → Unclassified → Unclassified → Mussel Surface → Marine Microbial Communities From Hydrothermal Vents In The Atlantic And Pacific Ocean

Source Dataset Sampling Location

• Location Name: Pacific Ocean: East Pacific Rise
• Coordinates
  • Lat. (^o): 9.8441
  • Long. (^o): -104.2967
  • Depth (m): 2503

Associated Families

Family	Category	Number of Sequences	3D Structure?
F037755	Metagenome / Metatranscriptome	167	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0256844_100667951	F037755	N/A	MAHDVSEYLQFVARAKVPDTKVMIYMAIVIFSFFFPFSYMYTKYHFVNCLSHRFEVYAVKNGGYKKFREKMFKTHKIPGNWHGNYT