Scaffold Ga0256844_10000597

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0256844_10000597

Scaffold Ga0256844_10000597

Overview

Basic Information
Taxon OID	3300028042 Open in IMG/M
Scaffold ID	Ga0256844_10000597 Open in IMG/M
Source Dataset Name	Mussel associated microbial communities from hydrothermal vent at the East Pacific Rise, Pacific Ocean - Mussels
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	13829
Total Scaffold Genes	23 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	5 (21.74%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mollusca → Shell → Unclassified → Unclassified → Mussel Surface → Marine Microbial Communities From Hydrothermal Vents In The Atlantic And Pacific Ocean

Source Dataset Sampling Location
Location Name	Pacific Ocean: East Pacific Rise
Coordinates	Lat. (^o)	9.8441	Long. (^o)	-104.2967	Alt. (m)		Depth (m)	2503
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F055744	Metagenome / Metatranscriptome	138	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0256844_100005973	F055744	N/A	MTNYGNGFNWTELYHMPIHWRRFYFNKLLQSKKKEKEEYDKSNNNGSASRPPLRVKK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.