Scaffold Ga0247719_1142624

Overview

Basic Information

• Taxon OID: 3300028041
• Scaffold ID: Ga0247719_1142624
• Source Dataset Name: Soil microbial communities from hillslope of Landscape Evolution Observatory, University of Arizona, Oracle, AZ, United States - 4-1-E_D
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 569
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Hillslopes Of Landscape Evolution Observatory, University Of Arizona, Oracle, Az, United States

Source Dataset Sampling Location

• Location Name: USA: Arizona
• Coordinates
  • Lat. (^o): 32.5788
  • Long. (^o): -110.8509
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067782	Metagenome / Metatranscriptome	125	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0247719_11426241	F067782	N/A	LLQPLDLLRRPTSALYRAYTAPADEASGDLPSAYRYGPNRVELDGHPVDVGFSIELTIDPEVQALAQKTAACYTGRQDACRALGIRRREDGARPVGHQMIEGAVVRMAAVAIIDVASGRIDALAGTMSPCTRQEYDGPGRSGDCDSRLPYPIRYRPDALLNPAVFHDAMPASVIKPIMAAGLSSASGR