Basic Information | |
---|---|
Taxon OID | 3300028041 Open in IMG/M |
Scaffold ID | Ga0247719_1069826 Open in IMG/M |
Source Dataset Name | Soil microbial communities from hillslope of Landscape Evolution Observatory, University of Arizona, Oracle, AZ, United States - 4-1-E_D |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 919 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Hillslopes Of Landscape Evolution Observatory, University Of Arizona, Oracle, Az, United States |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Arizona | |||||||
Coordinates | Lat. (o) | 32.5788 | Long. (o) | -110.8509 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F035359 | Metagenome / Metatranscriptome | 172 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0247719_10698261 | F035359 | N/A | SRLLETASGASVWSSSSWARRPVGGVEFSADRGVSGGVRGGDAREDMLPALVHHLTHDFRPSTVRQPAP |
⦗Top⦘ |