NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0247704_1000595

Scaffold Ga0247704_1000595


Overview

Basic Information
Taxon OID3300028040 Open in IMG/M
Scaffold IDGa0247704_1000595 Open in IMG/M
Source Dataset NameSoil microbial communities from hillslope of Landscape Evolution Observatory, University of Arizona, Oracle, AZ, United States - 4-1-W_N
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)9999
Total Scaffold Genes16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)13 (81.25%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Hillslopes Of Landscape Evolution Observatory, University Of Arizona, Oracle, Az, United States

Source Dataset Sampling Location
Location NameUSA: Arizona
CoordinatesLat. (o)32.5789Long. (o)-110.8512Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F104558Metagenome / Metatranscriptome100Y

Sequences

Protein IDFamilyRBSSequence
Ga0247704_100059513F104558AGGAGGVHALSTWADEDEFCAADPRRRTSSEVDYGATWRIAGSNDAWRLSWLRDTGELYLCRADGYDGSCTDVRVLALLEREPDVDALLDGWRDLRFDPDGLSWLAQRVSPLVAA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.