Scaffold Ga0256845_1169239

Overview

Basic Information

• Taxon OID: 3300028029
• Scaffold ID: Ga0256845_1169239
• Source Dataset Name: Tube worm associated microbial communities from hydrothermal vent at the East Pacific Rise, Pacific Ocean - Riftia
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 719
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Annelida → Integument → Unclassified → Unclassified → Tube Worm Surface → Marine Microbial Communities From Hydrothermal Vents In The Atlantic And Pacific Ocean

Source Dataset Sampling Location

• Location Name: Pacific Ocean: East Pacific Rise
• Coordinates
  • Lat. (^o): 9.8441
  • Long. (^o): -104.2967
  • Depth (m): 2503

Associated Families

Family	Category	Number of Sequences	3D Structure?
F031503	Metagenome / Metatranscriptome	182	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0256845_11692391	F031503	AGGAGG	MDLNEMRELFKETANIHTPEGLAAYRAFAAALTTPILQKIELESIMRSLFTVEKLAPGAQAVYPVAEDFEIPVWVLPGLSYVAQNFIEGIGEEVFVPTFTIDASADWKINYARDSRIDIAQRAAANAAKRLAAYEEECG