Scaffold Ga0247723_1080984

Overview

Basic Information

• Taxon OID: 3300028025
• Scaffold ID: Ga0247723_1080984
• Source Dataset Name: Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 854
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Source Dataset Sampling Location

• Location Name: USA: West Virginia
• Coordinates
  • Lat. (^o): 39.6017
  • Long. (^o): -79.9761
  • Depth (m): 2281

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029439	Metagenome / Metatranscriptome	188	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0247723_10809841	F029439	N/A	VVKMTTLNTITLEPNHVMASSNTGSPMVFRNTVGNYISRKAYLEMLATKQGVVSHRYLSPNESRWVMNNTKVGN