Scaffold Ga0265353_1000230

Overview

Basic Information

• Taxon OID: 3300028015
• Scaffold ID: Ga0265353_1000230
• Source Dataset Name: Soil microbial communities from Maridalen valley, Oslo, Norway - NSE6
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2546
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Magnetococcales → Magnetococcaceae → Magnetococcus → Magnetococcus marinus (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil, Plant Litter And Rhizosphere Microbial Communities From European Coniferous Forests

Source Dataset Sampling Location

• Location Name: Norway: Oslo
• Coordinates
  • Lat. (^o): 59.997
  • Long. (^o): 10.7902

Associated Families

Family	Category	Number of Sequences	3D Structure?
F070443	Metagenome / Metatranscriptome	123	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0265353_10002303	F070443	GGA	MIGLEGATCNTALIPEMEEIGANILLAEHIGRALVVGSEPADRLDVDVPGPLGKAGKPHVVDHTLTQRGHGRSPFGFKRQDLCPGTDQIPQHAVLNDYAFYGEAVQSNLQRRLLDEA