Scaffold Ga0265344_102896

Overview

Basic Information

• Taxon OID: 3300028011
• Scaffold ID: Ga0265344_102896
• Source Dataset Name: Plant litter microbial communities from Maridalen valley, Oslo, Norway - NLE1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 558
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter → Soil, Plant Litter And Rhizosphere Microbial Communities From European Coniferous Forests

Source Dataset Sampling Location

• Location Name: Norway: Oslo
• Coordinates
  • Lat. (^o): 59.9979
  • Long. (^o): 10.7895

Associated Families

Family	Category	Number of Sequences	3D Structure?
F083206	Metagenome / Metatranscriptome	113	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0265344_1028961	F083206	N/A	RQSRLLADIVAKVFSGWRTKILRAAEAFYARRREGPYRFIQNRSRTSVVALKRDTEAEKSEDQLSRDF