NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209168_10001914

Scaffold Ga0209168_10001914


Overview

Basic Information
Taxon OID3300027986 Open in IMG/M
Scaffold IDGa0209168_10001914 Open in IMG/M
Source Dataset NameSurface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)15651
Total Scaffold Genes22 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)18 (81.82%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil → Surface Soil Microbial Communities From Centralia Pennsylvania, Which Are Recovering From An Underground Coalmine Fire.

Source Dataset Sampling Location
Location NameUSA: Pennsylvania, Centralia
CoordinatesLat. (o)40.7999Long. (o)-76.3402Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003165Metagenome / Metatranscriptome504Y
F004246Metagenome / Metatranscriptome447Y
F006203Metagenome / Metatranscriptome379Y
F015646Metagenome / Metatranscriptome253Y

Sequences

Protein IDFamilyRBSSequence
Ga0209168_100019142F006203AGGAGGMLRSVVELMGDLLLSALMVLLGSCIVGSIVAALRAVSGGS
Ga0209168_100019143F015646GGAMKTVYFAVVLSLTYLLDLGGSAYAARNNAHSVEISDAVQIGGTKLKPGNYKVEWQGTGPAVQVSFQQNGKTVVTVPGMLKTNDDQVIRDAIVTEATGTGASTLKEIDFRHLKQALVFDHNLGSM
Ga0209168_100019145F004246GAGGMIDDWDEREDAVAAGSICPVPDCGALVVSYRPLERTGRDNSRSWCEFTCLHCGIDFSVPDDELIFQSVPKEWLLARVQAV
Ga0209168_100019146F003165AGGAGMAKVIEFYVPKNLRKPLKWAPQLQFGKVIEFSSRTKKSA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.