Scaffold Ga0209629_10083233

Overview

Basic Information

• Taxon OID: 3300027984
• Scaffold ID: Ga0209629_10083233
• Source Dataset Name: Cubitermes ugandensis P5 segment gut microbial communities from Kakamega Forest, Kenya - Cu122 P5 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3195
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Lepidosauria → Squamata → Bifurcata → Unidentata → Episquamata → Toxicofera → Iguania → Phrynosomatidae → Phrynosomatinae → Sceloporus → Sceloporus undulatus (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut → Cubitermes And Nasutitermes Termite Gut Microbial Communities From Max Planck Institute For Terrestrial Microbiology, Germany

Source Dataset Sampling Location

• Location Name: Kakamega Forest, Kenya
• Coordinates
  • Lat. (^o): 0.2917
  • Long. (^o): 34.856

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003646	Metagenome	475	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209629_100832335	F003646	GGGGG	VSRYAATPLIVALSPGHSVVTRFRPWSPIAKGNHLDRAEKNPKVAQTTGTVDVFDPHSFISGPTSRRSSACPNLHE