Scaffold Ga0209284_10542855

Overview

Basic Information

• Taxon OID: 3300027983
• Scaffold ID: Ga0209284_10542855
• Source Dataset Name: Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-03 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 552
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater → Freshwater Microbial Communities From Lake Liftoff Mats And Glacier Meltwater In Antarctica

Source Dataset Sampling Location

• Location Name: Lake Fryxell, Antarctica
• Coordinates
  • Lat. (^o): -77.605
  • Long. (^o): 163.163
  • Depth (m): 18

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028719	Metagenome	190	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209284_105428551	F028719	N/A	GNMWDSLSCLLTLLKSFDKNNPEMGIDSVARQMHQRTVQHYWVNIVKQQVTGGGCPTLRDTLIQPMEAALNQPTFLIQAQALLGNVISEDTTQRNAGVKSIINKDRQVVPKRMRLGSRLAVNTHNMGGRFEESVKNTRWSMSPQEAGDGLESIIEFQVQIKGHSKREYEDKWQGWQNWTDEKLA