NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209702_10010349

Scaffold Ga0209702_10010349


Overview

Basic Information
Taxon OID3300027976 Open in IMG/M
Scaffold IDGa0209702_10010349 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)10030
Total Scaffold Genes21 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)20 (95.24%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater → Freshwater Microbial Communities From Lake Liftoff Mats And Glacier Meltwater In Antarctica

Source Dataset Sampling Location
Location NameLake Fryxell, Antarctica
CoordinatesLat. (o)-77.605Long. (o)163.163Alt. (m)Depth (m)18
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003539Metagenome / Metatranscriptome480Y
F003658Metagenome474Y

Sequences

Protein IDFamilyRBSSequence
Ga0209702_1001034911F003539GAGGMNYIADYNDMVQMLAAEYANKYKMLQKNDIAQELWVWFVGHDTKLKEWEDLEQKDKDKLIAKSLRNAALKYCEREKARSIGYDLSDLYYYDASVIEAFLPSIIGNTYEIPQSIQDLNVKFGTGQASEGNNWLSLRSDIAKAFNKLSEMKQNILRLRFSVESPDWAILSKDMDSTPDGARMKVQRAVNSLIKNLGGWKPYND
Ga0209702_1001034912F003658GGAMTDDLRGVPTFACICGCLMFEITVMWDAETREVGWYDLAQKCKDCGIVTTAPTPIDWKDC

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.