NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209401_1000639

Scaffold Ga0209401_1000639


Overview

Basic Information
Taxon OID3300027971 Open in IMG/M
Scaffold IDGa0209401_1000639 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)23568
Total Scaffold Genes39 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)23 (58.97%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Montjoie, Canada
CoordinatesLat. (o)45.4091Long. (o)-72.0994Alt. (m)Depth (m)7
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F017307Metagenome / Metatranscriptome241N
F045750Metagenome / Metatranscriptome152N
F064717Metagenome / Metatranscriptome128N

Sequences

Protein IDFamilyRBSSequence
Ga0209401_10006391F017307N/ANKLQQKTAIGKSVPAGQLKAEEKDFSKLSQKEQRDALMRAMREFDRESNQ
Ga0209401_100063938F064717AGGAGMLGPVTAFKDPDPKIPRRWEAVPEEIKEAILKEHATFTCRELAKKYGISSSCAWNIMNKKNKQTNKQ
Ga0209401_100063939F045750GAGGMETVMSRIGRMLGLRMHNTNRTVCPVPQSKQTVSSGPDTIAIDKAVSKKRRKLLKHTYMKINDSIIKIKELRLKGYTYKAIGDEMKISKQRVSQIISASKKRDDDKNKWTSGLSTRNVLLMEKLGVEDKATAIMLIETREIVPFKWPNFGRRSYHDLCAWLDTQPIDPGLGRHCPHCGK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.