Scaffold Ga0208549_124887

Overview

Basic Information

• Taxon OID: 3300027933
• Scaffold ID: Ga0208549_124887
• Source Dataset Name: Hot spring microbial mat communities from Yellowstone National Park, Wyoming, USA - BED_host_MetaG (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 738
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Extremophilic Microbial Mat Communities From Usa And Mexico

Source Dataset Sampling Location

• Location Name: USA: Yellowstone National Park
• Coordinates
  • Lat. (^o): 44.7315
  • Long. (^o): -110.7113

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026606	Metagenome / Metatranscriptome	197	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208549_1248871	F026606	N/A	VGELREKIIEKAVWLNKDYSKMVILRIYSDGSYDIGIGQKGSYDGLSNKERLWVEFSLIEPWDLPEFETIIENEDGEGYIDSDGFGYDVDDLLDAVRTSVASGFYDKFEYEWKKFLREFNDWLEGLEGE