NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209069_10015114

Scaffold Ga0209069_10015114


Overview

Basic Information
Taxon OID3300027915 Open in IMG/M
Scaffold IDGa0209069_10015114 Open in IMG/M
Source Dataset NameFreshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3670
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds → Freshwater And Sediment Microbial Communities From Various Areas In North America, Analyzing Microbe Dynamics In Response To Fracking

Source Dataset Sampling Location
Location NameUSA: Pennsylvania
CoordinatesLat. (o)41.5935Long. (o)-78.5142Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F053522Metagenome / Metatranscriptome141N
F062199Metagenome / Metatranscriptome131N
F079173Metagenome / Metatranscriptome116Y

Sequences

Protein IDFamilyRBSSequence
Ga0209069_100151142F053522AGGAMQTATRPSRKTQAAPAISTISAAAPAPEAQVDVPAPRMILPIPQSAMQDAAFARNWWRVVIDGERTPYERVLTDVAVWAPNEAKLRAGDLVEVLDERSTLFALLYLVEHVPAKFIRFAELIKAPLGGLAIGKIEARGSHYAQWRGPAKRWCIIGPTGTVVRDGILSKEEAERDVTTRNMPTSTAFVSHPRM
Ga0209069_100151143F079173GGAGMHRYREFGLISERDEVLRRAFRDGFKRAGLSSAQFTDALAWYRDHAMLADDESQLAEAFGQFASGQGWTAEQRDRAIDLHKVIGEIGPESVMLEPQPDDDRAVLNRADDLLRNDPARYWGDSDLQDAVFEARERLNDLASTAVDAPTQKANGDRQRIDEIEALLRDPSGDGQRRYWADAGLRSDYGQALARLQADTHGSDGDNAAQSSPTSVEGGPAPPNA
Ga0209069_100151144F062199GGAGMPALTQDNVLLWLHGRRLGLVGDGSFGGSTGLMVDTQLVGSKRGPVVAQLAIGSNGVGNIAFPAAVDGDIVIFALDLTTPANVTSSFEAVVSTAGQIRQISAANLSGKSIFFLIAPAS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.