NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207428_10004336

Scaffold Ga0207428_10004336


Overview

Basic Information
Taxon OID3300027907 Open in IMG/M
Scaffold IDGa0207428_10004336 Open in IMG/M
Source Dataset NamePopulus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)13548
Total Scaffold Genes15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (40.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere → Populus Root And Rhizosphere Microbial Communities From Tennessee, Usa

Source Dataset Sampling Location
Location NameUSA: Tennessee
CoordinatesLat. (o)35.8444Long. (o)-83.9599Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013098Metagenome / Metatranscriptome274Y
F014275Metagenome / Metatranscriptome264Y
F015750Metagenome / Metatranscriptome252Y
F016870Metagenome / Metatranscriptome244N

Sequences

Protein IDFamilyRBSSequence
Ga0207428_1000433610F016870GGAGGMYDRAIDRMSDGASEFLVQFYLNSPKLSITVMLATWLMLFFVALWYFVLLPATSNNLVNGSFETRLVGWGTGWLEDFPAYRGASRLNQYLATRSSQTGQLAVADWRSDPTEHRSGGRFALLVEHRSDKQNEVYSTLSQRIRVRPRTGYNVQFWAKVDRMDHDGDLWLSPNGGSVAWDEPRIEIKGVGKGWQFYRLDFNSGDRVDLDVRFVAEGPLKAWIDDVVVSRVPAGETWLEKVGSWLGSLWAILR
Ga0207428_1000433612F014275AGGAGGMHRLVVRLDRAGAHKQVTRWKRQMDQSIRRAVKASRRAIHATNHSASPHKAERMMLKTKKAVVKAAMAL
Ga0207428_1000433614F015750N/AMDFATIRATIRRKLESGRLPLEKAARVLGRSATGEACAACDMTIGPGQLALDGLARKPGTKVMQLHLRCFELWTQERYSLLRERDRRPAGLSSLERQPA
Ga0207428_100043369F013098N/AMRLAWLAAVCAVSVLVGGCATAPFVGYRNGPVTLYIGDVRHVCAAGGSNNRGCTVRYPNGRIEVYCADGDYECLAHELRHVADPAWEHDLDQRSVSAK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.