Scaffold Ga0209737_10909294

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0209737_10909294

Scaffold Ga0209737_10909294

Overview

Basic Information
Taxon OID	3300027904 Open in IMG/M
Scaffold ID	Ga0209737_10909294 Open in IMG/M
Source Dataset Name	Cubitermes ugandensis P3 segment gut microbial communities from Kakamega Forest, Kenya - Cu122 P3 (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	858
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut → Cubitermes And Nasutitermes Termite Gut Microbial Communities From Max Planck Institute For Terrestrial Microbiology, Germany

Source Dataset Sampling Location
Location Name	Kakamega Forest, Kenya
Coordinates	Lat. (^o)	0.2917	Long. (^o)	34.856	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F022215	Metagenome	215	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209737_109092941	F022215	N/A	ELETSGIQDLRAKYKQNWINRLEIMDNARLPIHALKYKPRRRKDHGRPRKRWQRLDAGTFQAT

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.