Scaffold Ga0209427_10527545

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0209427_10527545

Scaffold Ga0209427_10527545

Overview

Basic Information
Taxon OID	3300027901 Open in IMG/M
Scaffold ID	Ga0209427_10527545 Open in IMG/M
Source Dataset Name	Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-36_30 (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	884
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment → Marine Sediment Microbial Communities From White Oak River Estuary, North Carolina

Source Dataset Sampling Location
Location Name	White Oak River estuary, North Carolina, USA
Coordinates	Lat. (^o)	34.640199	Long. (^o)	-77.109447	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010077	Metagenome	308	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209427_105275451	F010077	AGGAG	MGWLKARFGEASTMAGLGVIAMVVIPLVPPQYQLLAQGIAAALGIGGVVRPENGK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.