Scaffold Ga0209253_10000113

Overview

Basic Information

• Taxon OID: 3300027900
• Scaffold ID: Ga0209253_10000113
• Source Dataset Name: Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 57335
• Total Scaffold Genes: 51
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 34 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment → Freshwater Lake Sediment Microbial Communities From The University Of Notre Dame, Usa, Of Lakes That Contribute To Methane Emissions

Source Dataset Sampling Location

• Location Name: University of Notre Dame, Indiana, USA
• Coordinates
  • Lat. (^o): 41.7
  • Long. (^o): -86.23

Associated Families

Family	Category	Number of Sequences	3D Structure?
F041837	Metagenome / Metatranscriptome	159	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209253_100001136	F041837	AGGA	MEAFSPEFAQHWLAARSASPDERADGRPEDSLSPAQQVALEELADRITAARSVY