Scaffold Ga0209624_10798407

Overview

Basic Information

• Taxon OID: 3300027895
• Scaffold ID: Ga0209624_10798407
• Source Dataset Name: Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 620
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location

• Location Name: Algoma, Ontario, Canada
• Coordinates
  • Lat. (^o): 46.42
  • Long. (^o): -83.37

Associated Families

Family	Category	Number of Sequences	3D Structure?
F055140	Metagenome / Metatranscriptome	139	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209624_107984071	F055140	AGGAG	MSRHVLSVRYVDVLPMLGLGLVFLWLCLTGVSVRELCASAALTVTGYLRPRPDPAVERALRAAFAELDRDLA