NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209624_10000535

Scaffold Ga0209624_10000535


Overview

Basic Information
Taxon OID3300027895 Open in IMG/M
Scaffold IDGa0209624_10000535 Open in IMG/M
Source Dataset NameForest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)33378
Total Scaffold Genes35 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)29 (82.86%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location
Location NameAlgoma, Ontario, Canada
CoordinatesLat. (o)46.42Long. (o)-83.37Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F038574Metagenome / Metatranscriptome165Y
F046833Metagenome / Metatranscriptome150Y
F067999Metagenome / Metatranscriptome125Y
F087858Metagenome / Metatranscriptome110Y

Sequences

Protein IDFamilyRBSSequence
Ga0209624_1000053515F087858AGAAGMDMKDVMNQVRKELREQPGSRFSEIYLRTVERGASGANVRHALTEMLKRDEVRINEGKWRLIAPMERRKSASPTFH
Ga0209624_100005352F067999AGGAGMNYDKVQEISAEMNPLLNEQTPVITNPMRITLAETPQPEIGAYRAGNDRLHELSEELSKLDGRTLRAYRFHSAWLIRIVPPHTDISSWLASQWRRGAAVAHAVRIAVTTTRAIETDEIRAARAQRTKEEGKEVRAIADKISNYACSVHRRYPSGEVVVGENDLAVQLRKRQDKVGTALNLLLGEQKVKKASLRGYWKLNV
Ga0209624_1000053521F046833AGGAGGMNESDVKSQDAQSWKNLYRAAVLETNTELIPRRVLEARKAAAERALRLIREADDGEPELRDLAHASRVLDELNGRCQAAKHSRPKQSTPQDQGLDEATTSISA
Ga0209624_1000053528F038574N/AMGCRMATFDQFPALVCKNCFRPIPLPPATRPDTFEGQGFWPEGGSRRNFLCPACRHVHGYSAPDVQLVLPYTDPRRAGSSYNVVYIRLQCGVQGCSSILRIRTLMAFDKRPHDEALAMLATSRAQAIACNNGHTLSGPIVPYGLAFDARFDEDWEVGEGWNRRTPARMCA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.