NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209068_10001521

Scaffold Ga0209068_10001521


Overview

Basic Information
Taxon OID3300027894 Open in IMG/M
Scaffold IDGa0209068_10001521 Open in IMG/M
Source Dataset NameFreshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)11511
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (80.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds → Freshwater And Sediment Microbial Communities From Various Areas In North America, Analyzing Microbe Dynamics In Response To Fracking

Source Dataset Sampling Location
Location NamePennsylvania, USA
CoordinatesLat. (o)41.1289Long. (o)-78.4195Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000262Metagenome / Metatranscriptome1428Y
F000646Metagenome / Metatranscriptome962Y
F035529Metagenome / Metatranscriptome172Y
F089334Metagenome / Metatranscriptome109N

Sequences

Protein IDFamilyRBSSequence
Ga0209068_1000152110F000646GGAGGMKTKMNSILLCLIFAAFSTSALAKSKSDVRDVTGCLSKGDSAREFLLTGNDGSTWEVRSSRVPLAEHVGHTVTATGVVSNATMHNMKEDAKEAAKDSGMKKSDAEHGHMTVTKVKMVSDSCK
Ga0209068_100015214F035529AGGAMHPEDLMNPDMLSEILLLVSGTMILVTLVLILVAALTQTAALT
Ga0209068_100015216F089334AGGAGMKRIGILVLMYVVGGISGVVYHSTTTGAVDRARIAALDGALKERNEKLEKCTTALIDGLHPTVTVPPDKTK
Ga0209068_100015217F000262AGGMSHKLKRHERICLTWITILVALAAVSCNGQDFGVLQPTPEDLCKCLPIEPDIADYRHLAKHVPIPNMAAQEVSVEIILTWSQDPVIPPDTPRTGRELEVFHIANAFLQNASVNAVDCDVVMEISHNADKSSSRMIVETPVDTEYCGARQNMQAQLKQHGFRLDSQHGGELPQALPVDVVGMAFEDFEHDRGPVATLWELHPAIVTLR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.