Scaffold Ga0209380_10204517

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0209380_10204517

Scaffold Ga0209380_10204517

Overview

Basic Information
Taxon OID	3300027889 Open in IMG/M
Scaffold ID	Ga0209380_10204517 Open in IMG/M
Source Dataset Name	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1159
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil → Soil Microbial Communities From The Hubbard Brook Experimental Forest, New Hampshire, Under Manipulated Climate Change Conditions.

Source Dataset Sampling Location
Location Name	USA: New Hampshire, Hubbard Brook experimental Forest
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007671	Metagenome / Metatranscriptome	347	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209380_102045172	F007671	GGAGG	LRLGYTEADLQKLDELAGGANFEQPEDIRRVIDGYQYLDDWRANYRIQSVRSSLHSPRITCVDGAIFSYGLLELLFPETKRRLLAIHRRDPAKDEECGHCVALYWAGEHHVGSFSKSSFPGLGHRDAEFSDETAIAASYAKAYVAMSFEPLYFGVTTLEEAAPDLDWRFHEGELNQISDRLQASYEYGFMVEKTQR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.