Scaffold Ga0255055_10037136

Overview

Basic Information

• Taxon OID: 3300027881
• Scaffold ID: Ga0255055_10037136
• Source Dataset Name: Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_27
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Restricted
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).

Scaffold Components

• Scaffold Length (bps): 2746
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → unclassified viruses → Circular genetic element sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater → Methane Metabolizing Microbial Communities From Different Methane-Rich Environments From Various Locations

Source Dataset Sampling Location

• Location Name: Canada: British Columbia
• Coordinates
  • Lat. (^o): 50.0528611
  • Long. (^o): -123.8211389
  • Depth (m): 425

Associated Families

Family	Category	Number of Sequences	3D Structure?
F055295	Metagenome	139	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0255055_100371365	F055295	N/A	NMAKYDISDVFYLDTNLSLGTDFDAGTQVSSVLDVSSYVNPIGQGRSKGTGLAIYRVQFTWSDSSGNRPVVAAETSGFRTALLAGYDTTQAAAAATDLSTNQLSGSNDLMIAGMDYYSPSSFAGVTTTPTIGTGMPFLEPSTDVPYVVVRDSIGLVAVSSINTLAAFKIGVRLSCAIITLNQATLNQLLRTQTV