NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209465_10041296

Scaffold Ga0209465_10041296


Overview

Basic Information
Taxon OID3300027874 Open in IMG/M
Scaffold IDGa0209465_10041296 Open in IMG/M
Source Dataset NameTropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2194
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil → Tropical Forest Soil Microbial Communities From Panama Analyzed To Predict Greenhouse Gas Emissions

Source Dataset Sampling Location
Location NamePanama: Oeste
CoordinatesLat. (o)9.1086Long. (o)-79.8436Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F044641Metagenome / Metatranscriptome154Y
F058377Metagenome135Y

Sequences

Protein IDFamilyRBSSequence
Ga0209465_100412962F058377AGGAGMLFDRTQPADYGSLLQEVAARTGFSSSDMQELLDCELNINHLLDYITAVVSDRMN
Ga0209465_100412963F044641N/AMLLIVVLPDVDLPDTAFHQGTAPLVVHARATTAPAAISIAAVFQLPDPIQISSPPRESVGLAENLDPNFRPILLRSIRR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.