NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209465_10030325

Scaffold Ga0209465_10030325


Overview

Basic Information
Taxon OID3300027874 Open in IMG/M
Scaffold IDGa0209465_10030325 Open in IMG/M
Source Dataset NameTropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2544
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (71.43%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil → Tropical Forest Soil Microbial Communities From Panama Analyzed To Predict Greenhouse Gas Emissions

Source Dataset Sampling Location
Location NamePanama: Oeste
CoordinatesLat. (o)9.1086Long. (o)-79.8436Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008324Metagenome / Metatranscriptome335Y
F068584Metagenome / Metatranscriptome124Y
F089331Metagenome / Metatranscriptome109N

Sequences

Protein IDFamilyRBSSequence
Ga0209465_100303252F089331GGAGGMTELRMLSLAAAIAALVAYYSIQFYRFAVEPARAHTTERAR
Ga0209465_100303253F068584GAGMSNILKPIDLTDRAIRRAVFAVLDGLAAVHRADRKGSERLLRMQERDKHQVREFIGGRP
Ga0209465_100303256F008324N/AVTDKLTIAVTFHPERGYVGTAPDLRLPVIALSLGGLRRKIEAAMLPDKVIVMQLDKAARLERDRRRLTGRPPPGFAGTSA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.