Scaffold Ga0209465_10008446

Overview

Basic Information

• Taxon OID: 3300027874
• Scaffold ID: Ga0209465_10008446
• Source Dataset Name: Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4537
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 6 (85.71%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil → Tropical Forest Soil Microbial Communities From Panama Analyzed To Predict Greenhouse Gas Emissions

Source Dataset Sampling Location

• Location Name: Panama: Oeste
• Coordinates
  • Lat. (^o): 9.1086
  • Long. (^o): -79.8436
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018251	Metagenome / Metatranscriptome	236	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209465_100084463	F018251	AGG	MRKTVILAIATTFLAGVSVVTGLARTVHNPIGETISARPVVHPLTTGTLTASVVPAT