Scaffold Ga0209397_10003460

Overview

Basic Information

• Taxon OID: 3300027871
• Scaffold ID: Ga0209397_10003460
• Source Dataset Name: Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3376
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 6 (85.71%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland → Wetland Microbial Communities From Old Woman Creek Reserve In Ohio, Usa

Source Dataset Sampling Location

• Location Name: Old Woman Creek National Estuarine Research Reserve, Ohio, USA
• Coordinates
  • Lat. (^o): 41.224
  • Long. (^o): -82.304
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F014273	Metagenome / Metatranscriptome	264	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209397_100034603	F014273	GGAGG	MMPEEFRRWIHRHINVVLSFLIGATFGISILALAYFSTRNNVAAEALRYGVQITGHPDIDEDMFWFFCGIVVGASVTCLTWWRDSKAQSVGLEKGDVLNRLFTDRTPPTARRPEL