Scaffold Ga0209023_10104801

Overview

Basic Information

• Taxon OID: 3300027870
• Scaffold ID: Ga0209023_10104801
• Source Dataset Name: Freshwater and sediment microbial communities from Lake Erie, Canada (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1998
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment → Freshwater And Sediment Microbial Communities From A Dead Zone In Lake Erie, Usa

Source Dataset Sampling Location

• Location Name: Lake Erie, Canada
• Coordinates
  • Lat. (^o): 42.285437
  • Long. (^o): -81.355591

Associated Families

Family	Category	Number of Sequences	3D Structure?
F105276	Metagenome	100	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209023_101048013	F105276	N/A	MRLFIIVIVIGLISCKKQDSPKQDSPNSCSEIGTIKKGSTLGLRCEDALFIVRDDNKIIQPVITHDLLNGFSEGDVIRFEHKEIYLGMVSCGENIETAELFCAEAPDK