Scaffold Ga0209023_10039691

Overview

Basic Information

• Taxon OID: 3300027870
• Scaffold ID: Ga0209023_10039691
• Source Dataset Name: Freshwater and sediment microbial communities from Lake Erie, Canada (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3707
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (83.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment → Freshwater And Sediment Microbial Communities From A Dead Zone In Lake Erie, Usa

Source Dataset Sampling Location

• Location Name: Lake Erie, Canada
• Coordinates
  • Lat. (^o): 42.285437
  • Long. (^o): -81.355591

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004054	Metagenome / Metatranscriptome	455	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209023_100396916	F004054	GGAGG	MEYGGRTLSMAMALVCVFASSGPAIADRLDAASIPAGAVYVCVTGSGKARTVTAIALDEKVAAICRRHTEMGPCQNARNECRRSGGRVYAADGNEVTAADEAAYDSKVMRMRVGP