Scaffold Ga0233415_10024984

Overview

Basic Information

• Taxon OID: 3300027861
• Scaffold ID: Ga0233415_10024984
• Source Dataset Name: Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Restricted
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).

Scaffold Components

• Scaffold Length (bps): 2396
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater → Methane Metabolizing Microbial Communities From Different Methane-Rich Environments From Various Locations

Source Dataset Sampling Location

• Location Name: Canada: British Columbia
• Coordinates
  • Lat. (^o): 48.6569
  • Long. (^o): -123.4875
  • Depth (m): 100

Associated Families

Family	Category	Number of Sequences	3D Structure?
F096216	Metagenome	105	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0233415_100249844	F096216	N/A	MRIPKSLKEVLVKDYIQINKIRSAEYDNPFTRTIDLLCIFNDRKDVLKCKPSELAVDLSHLLVEPSRILKQYFTINGKRYGIVNHINDLEAGQYMSFTTYLKGFADNPNVHIEQMPDILASVIFPVDKNNKVMAIEPSYFRNLADDIRNTVTIDEIYGVAVFF