Scaffold Ga0209503_10010968

Overview

Basic Information

• Taxon OID: 3300027859
• Scaffold ID: Ga0209503_10010968
• Source Dataset Name: Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4010
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (25.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location

• Location Name: South Atlantic Ocean
• Coordinates
  • Lat. (^o): -17.283
  • Long. (^o): 2.9768
  • Depth (m): 30

Associated Families

Family	Category	Number of Sequences	3D Structure?
F039593	Metagenome / Metatranscriptome	163	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0209503_100109688	F039593	N/A	SAWISELREQYATIGSRGPVPSGFGGLGEPQLMEHLDERFNGALDFVDEPVYRSVSTDLSWQPANDELYFDSDEPVYRSFGGFGSSTGAVEEVDEGLPGSHEAWMRSMPPLVQRQSACSH