Scaffold Ga0209013_10458948

Overview

Basic Information

• Taxon OID: 3300027858
• Scaffold ID: Ga0209013_10458948
• Source Dataset Name: Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 2 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 693
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine → Marine Microbial Communities From The Santa Barbara Channel Oil Seeps

Source Dataset Sampling Location

• Location Name: Coal Oil Point, Santa Barbara, CA
• Coordinates
  • Lat. (^o): 34.39192
  • Long. (^o): -119.84578
  • Depth (m): 47

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004928	Metagenome / Metatranscriptome	418	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209013_104589482	F004928	N/A	MGQALHSIESEPDHTVEIVVHITETLGEQRRGDLVAALEDNGGITTAEFCPLRYHLMLVRYDRDLYSSQDVLDRVTSQNVDARLIGPV