Scaffold Ga0209712_10046970

Overview

Basic Information

• Taxon OID: 3300027849
• Scaffold ID: Ga0209712_10046970
• Source Dataset Name: Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2628
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (83.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location

• Location Name: Arctic Ocean
• Coordinates
  • Lat. (^o): 79.0225
  • Long. (^o): -9.5247
  • Depth (m): 17

Associated Families

Family	Category	Number of Sequences	3D Structure?
F054353	Metagenome	140	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0209712_100469703	F054353	AGGAGG	MKAKLDKSANVWTPMIINITLETENEYNALKNIYAVQEVTSLDAEHRVRDRNVLTGLVSVIVEAIGK