Scaffold Ga0209501_10036195

Overview

Basic Information

• Taxon OID: 3300027844
• Scaffold ID: Ga0209501_10036195
• Source Dataset Name: Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3682
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (20.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean

Source Dataset Sampling Location

• Location Name: Arctic Ocean: Canada Basin
• Coordinates
  • Lat. (^o): 75.2588
  • Long. (^o): -156.0227
  • Depth (m): 208

Associated Families

Family	Category	Number of Sequences	3D Structure?
F023366	Metagenome / Metatranscriptome	210	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0209501_100361951	F023366	N/A	MDVDGASFTADIDQDNASTISLHHDGASADYVILQTGGSGDILTLTVNGASANVDIIQRD