Scaffold Ga0209089_10027653

Overview

Basic Information

• Taxon OID: 3300027838
• Scaffold ID: Ga0209089_10027653
• Source Dataset Name: Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3869
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (12.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean

Source Dataset Sampling Location

• Location Name: Arctic Ocean: Canada Basin
• Coordinates
  • Lat. (^o): 73.2247
  • Long. (^o): -150.2247
  • Depth (m): 177

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011190	Metagenome / Metatranscriptome	294	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209089_100276533	F011190	N/A	MDSLLDSIINFIGGLKKSFSGKDYLRDINQCGTCGKPSFFSNCLKCEIDEAYKGYNKRG