NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209089_10002085

Scaffold Ga0209089_10002085


Overview

Basic Information
Taxon OID3300027838 Open in IMG/M
Scaffold IDGa0209089_10002085 Open in IMG/M
Source Dataset NameMarine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)17886
Total Scaffold Genes15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)12 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean

Source Dataset Sampling Location
Location NameArctic Ocean: Canada Basin
CoordinatesLat. (o)73.2247Long. (o)-150.2247Alt. (m)Depth (m)177
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021397Metagenome / Metatranscriptome219Y
F056675Metagenome / Metatranscriptome137Y
F093989Metagenome / Metatranscriptome106N

Sequences

Protein IDFamilyRBSSequence
Ga0209089_1000208512F021397AGAAGMNIDAKFFGAIIFLIVQTCGAIWWASGLSAEVERLAGIQGRAIPALEAEAKQCGIEIHNLKKLTGDQKEVQESVKNLDVMLYRLQSIETMLDKILATKVR
Ga0209089_100020852F093989AGGAGMAGKQAFDNTNKGRFFLNERKTAKDPALSGPGNYNGSDMRVAAWINPNEDADNNKVWKAFDYLAENAVINMRFSEPKQKGAGQSSGSSDMDDDLPF
Ga0209089_100020854F056675AGGAGMKLVKVEWWDTVQSSGWDKADEVNIMKVSQIGYFLNESTWSEEGVLKLADTVAEDEYYGITAIPKGCVHRVTSFSGSVDLVEVF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.