NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209230_10136863

Scaffold Ga0209230_10136863


Overview

Basic Information
Taxon OID3300027836 Open in IMG/M
Scaffold IDGa0209230_10136863 Open in IMG/M
Source Dataset NameFreshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1388
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment → Freshwater And Sediment Microbial Communities From A Dead Zone In Lake Erie, Usa

Source Dataset Sampling Location
Location NameCanada: Lake Ontario
CoordinatesLat. (o)43.933506Long. (o)-78.003845Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003299Metagenome / Metatranscriptome495N
F004234Metagenome / Metatranscriptome447Y
F015420Metagenome / Metatranscriptome255Y

Sequences

Protein IDFamilyRBSSequence
Ga0209230_101368631F015420N/AMKKLINYFTPVGEEQIAFAKALMVVVTAVISILFLFPLLTLLS
Ga0209230_101368632F004234N/AMNFINLHKRDNTYWSNWTTSYDSTVYIEGTIEPFTYDAIETDDGDMSLFILSDANLNLLKSKL
Ga0209230_101368635F003299N/AMKRYKVVYKTFDYWNGPVKLVTRIIEAYDADHVKQLIQKNDDLILLIEEV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.