Scaffold Ga0209230_10027539

Overview

Basic Information

• Taxon OID: 3300027836
• Scaffold ID: Ga0209230_10027539
• Source Dataset Name: Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2817
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (71.43%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment → Freshwater And Sediment Microbial Communities From A Dead Zone In Lake Erie, Usa

Source Dataset Sampling Location

• Location Name: Canada: Lake Ontario
• Coordinates
  • Lat. (^o): 43.933506
  • Long. (^o): -78.003845

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076859	Metagenome / Metatranscriptome	117	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209230_100275392	F076859	GAGG	MARKFDIRRSMHKDMTYGALMELVKNKGVWHESTVSPEYSHLTDDGKDAIIHVVEEMFRGMQTIHNAEVKEEAKKQTMDALR