Scaffold Ga0209092_10047180

Overview

Basic Information

• Taxon OID: 3300027833
• Scaffold ID: Ga0209092_10047180
• Source Dataset Name: Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2687
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location

• Location Name: Fram Strait
• Coordinates
  • Lat. (^o): 69.2303
  • Long. (^o): 7.7302
  • Depth (m): 10

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033501	Metagenome / Metatranscriptome	177	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209092_100471801	F033501	N/A	MNAIEFINEMDRLAEVHFGEFGYDTCSQDEKKAVIKLLLHNTK