NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209985_10006600

Scaffold Ga0209985_10006600


Overview

Basic Information
Taxon OID3300027806 Open in IMG/M
Scaffold IDGa0209985_10006600 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8707
Total Scaffold Genes18 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (22.22%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From Lake Erie, Under A Cyanobacterial Bloom.

Source Dataset Sampling Location
Location NameUSA: Ohio, Lake Erie
CoordinatesLat. (o)41.69957Long. (o)-83.2941Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003267Metagenome / Metatranscriptome496N
F004837Metagenome / Metatranscriptome421Y
F008024Metagenome / Metatranscriptome340N

Sequences

Protein IDFamilyRBSSequence
Ga0209985_1000660015F003267GGAMKLIHYYHIYCGGGGQWQLIMHQHMMALCNYGLIEQLDEIRVGIVGPPDQRKVVKEILDNSLVAAKIKIVVTRTNAWEQATLTEMYKASQTEDAAYLYGHTKGSSDPSLINQLWCRSMVFFNIVAWERAIAELANVDAVGAYWLTKEEFPQIADHNNPDGYPYFAGTFWWAKSSHIRELGEPVREHRWQAEHWIGKREGMTVYNSCKGWPAPDKFVITF
Ga0209985_1000660018F008024N/AMKLQDLTIDQFQRIAALEFSPVLTDYDKRAGVVAIVEGVDVSLVREMPAKGLTKRYKTIIAEWNELPTLAYRRRFKAGGKWWIPTVFTD
Ga0209985_100066007F004837N/AMTQAEYLTAQKHRHYWEQYQAALFMRLSPEAVHDLQTILVAHGRPNTNWWCADCVKSALSYIYQEADQFAEANHHTVTHALNQSPQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.