Scaffold Ga0209229_10273510

Overview

Basic Information

• Taxon OID: 3300027805
• Scaffold ID: Ga0209229_10273510
• Source Dataset Name: Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 748
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment → Freshwater And Sediment Microbial Communities From A Dead Zone In Lake Erie, Usa

Source Dataset Sampling Location

• Location Name: Sandusky Bay, Ohio, USA
• Coordinates
  • Lat. (^o): 41.474889
  • Long. (^o): -82.854137

Associated Families

Family	Category	Number of Sequences	3D Structure?
F045098	Metagenome	153	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0209229_102735102	F045098	AGGA	MTSKELQMMYQQWCQGNEDHGFRWLDFVEMAARQFKQPESEVLRELQKHYWFVKNNK