NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209229_10018117

Scaffold Ga0209229_10018117


Overview

Basic Information
Taxon OID3300027805 Open in IMG/M
Scaffold IDGa0209229_10018117 Open in IMG/M
Source Dataset NameFreshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3020
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (50.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment → Freshwater And Sediment Microbial Communities From A Dead Zone In Lake Erie, Usa

Source Dataset Sampling Location
Location NameSandusky Bay, Ohio, USA
CoordinatesLat. (o)41.474889Long. (o)-82.854137Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000671Metagenome / Metatranscriptome945Y
F010248Metagenome / Metatranscriptome306Y
F011938Metagenome / Metatranscriptome285Y
F037227Metagenome / Metatranscriptome168Y

Sequences

Protein IDFamilyRBSSequence
Ga0209229_100181171F011938N/AFIHSEQCYGTVEKLGAFASVVRYTSDGIEYNELMENDEFTIVDEIVFKHVEESE
Ga0209229_100181172F000671GAGGMEKILCYSCNKSKNKLDVKKSTLLPINLLICETCVSGKLEPRWVVILAGRSNGADHVKEFIIKRRYLGSEITASELLV
Ga0209229_100181176F010248GAGMRKSERLRLLEMEMLRMQFQIEYLNTAVTLLLDENKVKGPDMDAGKWYAAKLNKNK
Ga0209229_100181178F037227AGGAGMAERQMTVLEGIIEDVAMELYQKLWNAIPAEEQTEDSSRAVGINSKETTLFVVQRFMDKFNAAAEELKDK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.