Scaffold Ga0233416_10079982

Overview

Basic Information

• Taxon OID: 3300027799
• Scaffold ID: Ga0233416_10079982
• Source Dataset Name: Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0_MG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Restricted
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).

Scaffold Components

• Scaffold Length (bps): 1112
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment → Methane Metabolizing Microbial Communities From Different Methane-Rich Environments From Various Locations

Source Dataset Sampling Location

• Location Name: Indonesia: South Sulawesi
• Coordinates
  • Lat. (^o): -2.7
  • Long. (^o): 121.4042
  • Depth (m): 60

Associated Families

Family	Category	Number of Sequences	3D Structure?
F035214	Metagenome	172	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0233416_100799822	F035214	AGGAGG	MRDAGLVGIGVVLGWLGSKSWSDPQCRMGLVIFLVATAVMTLVFALAVVGHGTQPHDRGDRNADDDRD