 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300027792 Open in IMG/M |
| Scaffold ID | Ga0209287_10029440 Open in IMG/M |
| Source Dataset Name | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1994 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → Candidatus Desulfacyla → Candidatus Desulfacyla euxinica | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment → Freshwater Sediment Microbial Communities From Cottonwood Lakes Research Site Near Jamestown, North Dakota, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | near Jamestown, North Dakota | |||||||
| Coordinates | Lat. (o) | 47.0991 | Long. (o) | -99.1044 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F039197 | Metagenome | 164 | Y |
| F067248 | Metagenome | 126 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209287_100294401 | F067248 | N/A | HPLREIIREPNEMVKPLKHKEILENLKLLADWLRVKYPGEHFELIVAGGAAMTLEGFKGQTTDIDLLSPKELPDSLKKGIAHVGRAKRLGAEWLNTSLANMLSTSARSVKLPNYFREISQTLEVSDNLKIGLISRQALISLKLYATTPTYRKHTEDLSNLRPSKREITEALRFVMSIDDSDPRKDDLRVVMKELGFDFDEIHHNLAKKSKPSR |
| Ga0209287_100294402 | F039197 | GGAG | VALGIPFDVPMIDEKVEGIIDVEALIMTTLLLIEQDRMATDLPAWFSRFSGLVNHQKLKTMFKTMPDQHRSVILEKVNQSPFSGAPKSIRDIFSLKPASEVVSKTIQMRERKLNTIENVADASIMIRSRLEYGTGFRADIIALTHIKGFGMKGTQFAKLLCTNDSTVSRVLGDLKACRFLDQDNERIGPVEPYPGLFISSQSLWNLCEIMDAAKFSSQELKQGALENLILRYDGLGTRILNGLI |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |