Scaffold Ga0209175_10006112

Overview

Basic Information

• Taxon OID: 3300027781
• Scaffold ID: Ga0209175_10006112
• Source Dataset Name: Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C2 DNA (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5153
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (28.57%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent → Wastewater Effluent Complex Algal Communities From Wisconsin, To Seasonally Profile Nutrient Transformation And Carbon Sequestration

Source Dataset Sampling Location

• Location Name: Milwaukee, Wisconsin, USA
• Coordinates
  • Lat. (^o): 43.023
  • Long. (^o): -87.895
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F042570	Metagenome / Metatranscriptome	158	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209175_100061124	F042570	N/A	MPLMGCAVATGLIFASLIKGISYAPDLEEVLFNYTTLGFAFVESFAFLLFFVAGLVLVF