Scaffold Ga0209502_10237102

Overview

Basic Information

• Taxon OID: 3300027780
• Scaffold ID: Ga0209502_10237102
• Source Dataset Name: Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 818
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean

Source Dataset Sampling Location

• Location Name: Arctic Ocean: Canada Basin
• Coordinates
  • Lat. (^o): 79.2466
  • Long. (^o): -150.0613
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F034719	Metagenome	174	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209502_102371022	F034719	AGGA	MENGTHRKSDKVWDYDAIDAQRNEEWGGIHKLITDHAVEKRVTAEEIAKRNSIFYNHKEINKH