Scaffold Ga0209464_10065074

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0209464_10065074

Scaffold Ga0209464_10065074

Overview

Basic Information
Taxon OID	3300027778 Open in IMG/M
Scaffold ID	Ga0209464_10065074 Open in IMG/M
Source Dataset Name	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1215
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment → Wetland Sediment Microbial Communities From St. Louis River Estuary, Michigan Under Dissolved Organic Matter Induced Mercury Methylation

Source Dataset Sampling Location
Location Name	USA: Michigan, St. Louis River estuary
Coordinates	Lat. (^o)	46.6972164	Long. (^o)	-92.3279105	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F072085	Metagenome	121	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209464_100650742	F072085	N/A	SCVRILKRIIEIIGTNHIGLTFHFGGLSQDKALKSMERFAKLVMPALR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.